Home > Product > Antimicrobial Peptides > Hyphancin-3E

Antimicrobial Peptides

Hyphancin-3E

[Price Inquiry]
CAT#
AF2460
Sequence
RWKFFKKIERVGQNVRDGLIKAGPAIQVLGAAKAL
Host Chemicals
Hyphantria cunea
Length
35
Activity
Antibacterial
SwissProt ID
P50721
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.