CAT# | AF2467 |
Sequence | RWKVFKKIEKVGRNIRDGVIKAGPAIAVVGQAKAL |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...