Home > Product > Antimicrobial Peptides > Hyphancin-3G

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Hyphancin-3G

[Price Inquiry]
CAT#
AF2465
Sequence
RWKVFKKIEKVGRHIRDGVIKAGPAITVVGQATAL
Host Chemicals
Hyphantria cunea
Length
35
Activity
Antibacterial
SwissProt ID
P50723
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.