Home > Product > Catalog Peptides > Others > IL-1β (178-207) (human)

Others

warning All products are for research use only. Not for human use.

IL-1β (178-207) (human)

[Price Inquiry]
CAT#
I03001
Sequence
LKEKNLYLSCVLKDDKPTLQLESVDPKNYP
M.W/Mr.
3492.05
Molecular Formula
C157H256N38O49S
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.