Home > Product > Catalog Peptides > Others > IL-1β (208-240) (human)

Others

IL-1β (208-240) (human)

Price Inquiry
CAT#
I03003
Sequence
KKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
M.W/Mr.
4108.78
Molecular Formula
C191H292N48O51S
Length
33

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.