Home > Product > Catalog Peptides > Others > IL-1β (208-240) (human)

Others

IL-1β (208-240) (human)

[Price Inquiry]
CAT#
I03003
Sequence
KKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
M.W/Mr.
4108.78
Molecular Formula
C191H292N48O51S
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.