Home > Product > Catalog Peptides > Others > IL-6 (88-121) (human)

Others

IL-6 (88-121) (human)

[Price Inquiry]
CAT#
I03007
Sequence
IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
M.W/Mr.
4023.53
Molecular Formula
C179H281N45O58S
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.