Home > Product > Catalog Peptides > Others > Intermedin (human)

Others

Intermedin (human)

Price Inquiry
CAT#
I04002
Sequence
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2
M.W/Mr.
5100.80
Molecular Formula
C219H349N69O66S3
Length
47

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.