Home > Product > Catalog Peptides > Others > Intermedin (human)

Others

Intermedin (human)

[Price Inquiry]
CAT#
I04002
Sequence
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2
M.W/Mr.
5100.80
Molecular Formula
C219H349N69O66S3
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.