Home > Product > Catalog Peptides > Others > Intermedin (rat)

Others

Intermedin (rat)

[Price Inquiry]
CAT#
I04001
Sequence
PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2
M.W/Mr.
5216.95
Molecular Formula
C226H361N75O64S2
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.