Home > Product > Antimicrobial Peptides > Ixosin-B

Antimicrobial Peptides

CAT#
AF2141
Sequence
QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY
Host Chemicals
Ixodes sinensis
Length
32
Activity
Antibacterial, Antifungal
SwissProt ID
A7UDM9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.