Home > Product > Antimicrobial Peptides > Kalata B16

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Kalata B16

[Price Inquiry]
CAT#
AF1909
Sequence
GIPCAESCVYIPCTITALLGCKCQDKVCYD
Host Chemicals
Oldenlandia affinis DC
Length
30
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.