Home > Product > Antimicrobial Peptides > Kalata B17

Antimicrobial Peptides

Kalata B17

[Price Inquiry]
CAT#
AF1908
Sequence
GIPCAESCVYIPCTITALLGCKCKDQVCYN
Host Chemicals
Oldenlandia affinis DC
Length
30
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.