Home > Product > Antimicrobial Peptides > Kaliocin-1

Antimicrobial Peptides

Kaliocin-1

[Price Inquiry]
CAT#
AF1999
Sequence
FFSASCVPGADKGQFPNLCRLCAGTGENKCA
Host Chemicals
Synthetic construct
Length
31
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.