Home > Product > Catalog Peptides > Others > Kelch 1

Others

CAT#
A40002
Sequence
IMWVVGGYMFNHSDYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKD
Length
51
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.