Home > Product > Catalog Peptides > Others > Kelch 2

Others

warning All products are for research use only. Not for human use.
CAT#
A40003
Sequence
IYMYGGKIDSTGNVTNELRVFHIHNESWVLLTPKAKEQYAVVGHSAHI
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.