Home > Product > Catalog Peptides > Others > Kelch 4

Others

CAT#
A40005
Sequence
ALYVHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRFFRYLHTAVIVSG
Length
52
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.