Home > Product > Catalog Peptides > Others > Kelch 5

Others

CAT#
A40006
Sequence
MLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPDLHHDVNRFGHSAVLHNS
Length
59
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.