Home > Product > Catalog Peptides > Others > Kisspeptin-54 (human)

Others

Kisspeptin-54 (human)

[Price Inquiry]
CAT#
K04002
Sequence
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
M.W/Mr.
5857.51
Molecular Formula
C258H401N79O78
Length
54
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.