Home > Product > Catalog Peptides > Various Products / Cancer Research > Kisspeptin-54 (human)

Various Products / Cancer Research

Kisspeptin-54 (human)

Price Inquiry
CAT#
K04002
Sequence
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
M.W/Mr.
5857.51
Molecular Formula
C258H401N79O78
Length
54

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.