Home > Product > Catalog Peptides > Others > Kisspeptin-54 (27-54) (human)

Others

warning All products are for research use only. Not for human use.

Kisspeptin-54 (27-54) (human)

[Price Inquiry]
CAT#
K04003
Sequence
IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
M.W/Mr.
3229.69
Molecular Formula
C149H226N42O39
Length
28
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.