Home > Product > Catalog Peptides > Various Products / Cancer Research > Kisspeptin-54 (27-54) (human)

Various Products / Cancer Research

Kisspeptin-54 (27-54) (human)

Price Inquiry
CAT#
K04003
Sequence
IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
M.W/Mr.
3229.69
Molecular Formula
C149H226N42O39
Length
28

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.