Home > Product > Antimicrobial Peptides > L-amino-acid oxidase

Antimicrobial Peptides

L-amino-acid oxidase

[Price Inquiry]
CAT#
AF1959
Sequence
KFEPPLPPKKAHKKFWEDDGIYYPPNHNFP
Host Chemicals
Bothropoides matogrossensis
Length
30
Activity
Antibacterial, Antiparasitic
SwissProt ID
B3EWI9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.