Home > Product > Antimicrobial Peptides > L-amino-acid oxidase

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

L-amino-acid oxidase

[Price Inquiry]
CAT#
AF2696
Sequence
DDRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV
Host Chemicals
Naja kaouthia
Length
38
Activity
Antibacterial
SwissProt ID
P0C2D4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.