Home > Product > Antimicrobial Peptides > L-amino-acid oxidase

Antimicrobial Peptides

L-amino-acid oxidase

Price Inquiry
CAT#
AF2696
Sequence
DDRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV
Host Chemicals
Naja kaouthia
Length
38
Activity
Antibacterial
SwissProt ID
P0C2D4

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.