Home > Product > Antimicrobial Peptides > Lactacin F

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Lactacin F

[Price Inquiry]
CAT#
AF3248
Sequence
NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN
Host Chemicals
Lactobacillus johnsonii VPI11088 (Laf+)
Length
48
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.