Home > Product > Antimicrobial Peptides > Lactacin F

Antimicrobial Peptides

Lactacin F

[Price Inquiry]
CAT#
AF3248
Sequence
NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN
Host Chemicals
Lactobacillus johnsonii VPI11088 (Laf+)
Length
48
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.