Home > Product > Antimicrobial Peptides > Lactocin 705

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Lactocin 705

[Price Inquiry]
CAT#
AF2258
Sequence
GMSGYIQGIPDFLKGYLHGISAANKHKKGRLGY
Host Chemicals
Lactobacillus casei CRL 705
Length
33
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.