Home > Product > Antimicrobial Peptides > Lactococcin G-a

Antimicrobial Peptides

Lactococcin G-a

[Price Inquiry]
CAT#
AF2777
Sequence
GTWDDIGQGIGRVAYWVGKALGNLSDVNQASRINRKKKH
Host Chemicals
Lactococcus lactis LMGT2081
Length
39
Activity
Antimicrobial
SwissProt ID
P36961
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.