Home > Product > Antimicrobial Peptides > Lactococcin G-a

Antimicrobial Peptides

Lactococcin G-a

Price Inquiry
CAT#
AF2777
Sequence
GTWDDIGQGIGRVAYWVGKALGNLSDVNQASRINRKKKH
Host Chemicals
Lactococcus lactis LMGT2081
Length
39
Activity
Antimicrobial
SwissProt ID
P36961

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.