Home > Product > Antimicrobial Peptides > Lactococcin Q alpha

Antimicrobial Peptides

Lactococcin Q alpha

Price Inquiry
CAT#
AF2796
Sequence
SIWGDIGQGVGKAAYWVGKAMGNMSDVNQASRINRKKKH
Host Chemicals
Lactococcus lactis QU 4
Length
39
Activity
Antibacterial
SwissProt ID
Q1JV79

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.