Home > Product > Antimicrobial Peptides > Lactococcin Q alpha

Antimicrobial Peptides

Lactococcin Q alpha

[Price Inquiry]
CAT#
AF2796
Sequence
SIWGDIGQGVGKAAYWVGKAMGNMSDVNQASRINRKKKH
Host Chemicals
Lactococcus lactis QU 4
Length
39
Activity
Antibacterial
SwissProt ID
Q1JV79
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.