Home > Product > Antimicrobial Peptides > Lactococcin Q beta

Antimicrobial Peptides

Lactococcin Q beta

[Price Inquiry]
CAT#
AF2425
Sequence
KKWGWLAWVEPAGEFLKGFGKGAIKEGNKDKWKNI
Host Chemicals
Lactococcus lactis QU 4
Length
35
Activity
Antibacterial
SwissProt ID
Q1JV78
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.