Home > Product > Antimicrobial Peptides > Lactocyclicin Q

Antimicrobial Peptides

Lactocyclicin Q

[Price Inquiry]
CAT#
AF3340
Sequence
LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
Host Chemicals
Lactococcus sp. strain QU 12
Length
61
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.