Home > Product > Antimicrobial Peptides > Lactocyclicin Q

Antimicrobial Peptides

Lactocyclicin Q

Price Inquiry
CAT#
AF3340
Sequence
LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
Host Chemicals
Lactococcus sp. strain QU 12
Length
61
Activity
Gram+ & Gram-,

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.