Home > Product > Catalog Peptides > Others > Laminin EGF-like 1

Others

Laminin EGF-like 1

[Price Inquiry]
CAT#
A40011
Sequence
CQCNGHSKCINQSICEKCENLTTGKHCETCISGFYGDPTNGGKCQP
Length
46
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.