Home > Product > Catalog Peptides > Others > Laminin EGF-like 2

Others

warning All products are for research use only. Not for human use.

Laminin EGF-like 2

[Price Inquiry]
CAT#
A40012
Sequence
CKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLRGTCYY
Length
49
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.