Home > Product > Antimicrobial Peptides > Lantibiotic lacticin 3147 A1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Lantibiotic lacticin 3147 A1

[Price Inquiry]
CAT#
AF1884
Sequence
CSTNTFSLSDYWGNNGAWCTLTHECMAWCK
Host Chemicals
Lactococcus lactis subsp. lactis
Length
30
Activity
Antibacterial
SwissProt ID
O87236
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.