Home > Product > Antimicrobial Peptides > Lantibiotic Pep5

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Lantibiotic Pep5

[Price Inquiry]
CAT#
AF2391
Sequence
TAGPAIRASVKQCQKTLKATRLFTVSCKGKNGCK
Host Chemicals
Staphylococcus epidermidis
Length
34
Activity
Antibacterial
SwissProt ID
P19578
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.