Home > Product > Antimicrobial Peptides > Latarcin 6a

Antimicrobial Peptides

Latarcin 6a

[Price Inquiry]
CAT#
AF2276
Sequence
QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL
Host Chemicals
Lachesana tarabaevi
Length
33
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.