Home > Product > Antimicrobial Peptides > Latarcin 6b

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Latarcin 6b

[Price Inquiry]
CAT#
AF2455
Sequence
QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL
Host Chemicals
Lachesana tarabaevi
Length
35
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.