CAT# | AF2346 |
Sequence | GETFDKLKEKLKTFYQKLVEKAEDLKGDLKAKLS |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...