Home > Product > Antimicrobial Peptides > Latarcin 7

Antimicrobial Peptides

Latarcin 7

[Price Inquiry]
CAT#
AF2346
Sequence
GETFDKLKEKLKTFYQKLVEKAEDLKGDLKAKLS
Host Chemicals
Lachesana tarabaevi
Length
34
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.