Home > Product > Antimicrobial Peptides > Laterosporulin

Antimicrobial Peptides

Laterosporulin

[Price Inquiry]
CAT#
AF3251
Sequence
ACQCPDAISGWTHTDYQCHGLENKMYRHVYAICMNGTQVYCRTEWGSSC
Host Chemicals
Brevibacillus sp. Strain GI-9
Length
49
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.