Home > Product > Antimicrobial Peptides > Latescidin 1

Antimicrobial Peptides

Latescidin 1

[Price Inquiry]
CAT#
AF2728
Sequence
LEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSL
Host Chemicals
Lates calcarifer
Length
38
Activity
Antimicrobial
SwissProt ID
G3FZS7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.