Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3215
Sequence
AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK
Host Chemicals
Bacillus subtilis
Length
47
Activity
Gram+ & Gram-,
SwissProt ID
PDB ID: 2B9K
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.