Home > Product > Antimicrobial Peptides > LEAP-2-RA1 peptide precursor, partial

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

LEAP-2-RA1 peptide precursor, partial

[Price Inquiry]
CAT#
AF3028
Sequence
QVSQRRGPRMTPFWRAVGNKPVGAFCQQGLECTTKVCRRGHCT
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
43
Activity
Antimicrobial
SwissProt ID
E3SYM8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.