Home > Product > Antimicrobial Peptides > Lebocin-like anionic peptide 1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Lebocin-like anionic peptide 1

[Price Inquiry]
CAT#
AF2930
Sequence
EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA
Host Chemicals
Galleria mellonella
Length
42
Activity
Antibacterial, Antifungal
SwissProt ID
P85211
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.