CAT# | AF2077 |
Sequence | DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY |
Activity | Antibacterial |
Host Chemicals | Bombyx mori | Length | 32 | SwissProt ID | P55796 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2456 | Vicin-like antimicrobial peptide 2a | Inquiry | ||
AF1632 | Pilosulin 2 | Inquiry | ||
AF813 | Maximin-H7 | Inquiry | ||
AF1905 | Vhr1 | Inquiry | ||
AF1251 | Brevinin-1Sa | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An overview of trifluoroacetyl tripeptide-2 Peptides are chains of amino acids joined by peptide bond. Peptides are mostly i ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...