Home > Product > Antimicrobial Peptides > Lebocin-1/2 precursor

Antimicrobial Peptides

Lebocin-1/2 precursor

[Price Inquiry]
CAT#
AF2078
Sequence
DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY
Host Chemicals
Bombyx mori
Length
32
Activity
Antibacterial
SwissProt ID
P54684
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.