Home > Product > Antimicrobial Peptides > Lebocin-4 precursor

Antimicrobial Peptides

Lebocin-4 precursor

[Price Inquiry]
CAT#
AF2079
Sequence
DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY
Host Chemicals
Bombyx mori
Length
32
Activity
Antibacterial
SwissProt ID
O15946
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.