Home > Product > Catalog Peptides > Others > Leptin (138-167) (human)

Others

warning All products are for research use only. Not for human use.

Leptin (138-167) (human)

[Price Inquiry]
CAT#
L03007
Sequence
SGYSTEVVALSRLQGSLQDMLWQLDLSPGC
M.W/Mr.
3253.68
Molecular Formula
C141H224N37O47S2
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.