Home > Product > Antimicrobial Peptides > Lichenicidin

Antimicrobial Peptides

Lichenicidin

[Price Inquiry]
CAT#
AF2157
Sequence
TITLSTCAILSKPLGNNGYLCTVTKECMPSCN
Host Chemicals
Bacillus licheniformis ATCC 14580 or VK 21
Length
32
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.