Home > Product > Antimicrobial Peptides > Lingual antimicrobial peptide

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Lingual antimicrobial peptide

[Price Inquiry]
CAT#
AF2527
Sequence
NSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCR
Host Chemicals
Bos taurus
Length
36
Activity
Antibacterial, Antifungal
SwissProt ID
Q28880
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.