Home > Product > Antimicrobial Peptides > Listeriocin 743A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Listeriocin 743A

[Price Inquiry]
CAT#
AF3009
Sequence
KSYGNGVQCNKKKCWVDWGSAISTIGNNSAANWATGGAAGWKS
Host Chemicals
Listeria innocua
Length
43
Activity
Antibacterial
SwissProt ID
Q9AGM4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.