Home > Product > Antimicrobial Peptides > Liver-expressed antimicrobial peptide 2

Antimicrobial Peptides

Liver-expressed antimicrobial peptide 2

[Price Inquiry]
CAT#
AF2841
Sequence
MTPFWRAVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
Host Chemicals
Bos taurus
Length
40
Activity
Antimicrobial
SwissProt ID
Q95JC3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.