Home > Product > Antimicrobial Peptides > Liver-expressed antimicrobial peptide 2

Antimicrobial Peptides

Liver-expressed antimicrobial peptide 2

[Price Inquiry]
CAT#
AF2842
Sequence
MTPFWRAVSLRPIGASCRDDSECLTRLCRKRRCSLSVAQE
Host Chemicals
Sus scrofa
Length
40
Activity
Antimicrobial
SwissProt ID
Q95JB4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.