Home > Product > Antimicrobial Peptides > Liver-expressed antimicrobial peptide-2

Antimicrobial Peptides

Liver-expressed antimicrobial peptide-2

[Price Inquiry]
CAT#
AF2949
Sequence
LRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCSTS
Host Chemicals
Larimichthys crocea
Length
42
Activity
Antimicrobial
SwissProt ID
H9BB31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.