Home > Product > Antimicrobial Peptides > Liver expressed antimicrobial peptide 2

Antimicrobial Peptides

Liver expressed antimicrobial peptide 2

[Price Inquiry]
CAT#
AF3118
Sequence
RLKRMTPFWRGVSLRPVGASCRDNSECITMLCRKNRCFLRTASE
Host Chemicals
Gallus gallus
Length
44
Activity
Antimicrobial
SwissProt ID
Q6QLQ6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.