Home > Product > Antimicrobial Peptides > Liver-expressed antimicrobial peptide 2-like

Antimicrobial Peptides

Liver-expressed antimicrobial peptide 2-like

[Price Inquiry]
CAT#
AF3125
Sequence
VVHAPRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCS
Host Chemicals
Oreochromis niloticus
Length
44
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.